PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P12090_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 473aa    MW: 52216 Da    PI: 6.7091
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P12090_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.9e-10326385564
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 
                            kr +r   NR +A rs +RK  +i+eLe kv++L++e + L  +l  l+  +a l+++++
  GSMUA_Achr8P12090_001 326 KRVKRILANRHSAARSKERKMRYIAELEHKVQTLQTETTNLSTQLTFLQRDSAGLTNQNH 385
                            899*******************************************99999999998885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-17322386IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599324387IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-10326383No hitNo description
SuperFamilySSF579592.56E-11326382No hitNo description
PfamPF001703.1E-9326384IPR004827Basic-leucine zipper domain
CDDcd147035.30E-22327378No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MDETGIGPMK QSPGNPFLSV SKQQQQYHVN PNATQAIGPY SNIGAECGKR SGVPPASPCS  60
QLPSLPPRSP PLAVAAQQLP PVARHHSRSR SQPTFFSLDS LPTLICRGDS SSTTSLSDSV  120
SADVSMDDHD ERDDLPPRKT HRRSQSDVPS AFFPPSLPLE NHWDVGLDAD AVSGDDLFNA  180
YMNLDGFDAL NSSEDNREDL NSRDSGSKTN AADSSENEAD SKAKEHLKGG LKRNAAGDPS  240
QVMAASRHCR SFSMDSFMGK FNLEEEPQKL LPSSGLRARQ SSKSNSFDVA PNTFSLEFGN  300
GLFTAAEMKK IMENEKLVEM AMTDPKRVKR ILANRHSAAR SKERKMRYIA ELEHKVQTLQ  360
TETTNLSTQL TFLQRDSAGL TNQNHELRFR LQAMDQQAQL RDALNEALTA EVQRLKLAAT  420
GLADAHPSKS LNQQASMDPQ RYQLQSKLQR AHVPPYQLQK QQDDTVMDSR SEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411441.10.0PREDICTED: transcription factor RF2a-like
TrEMBLM0TPR20.0M0TPR2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P12090_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.38e-97bZIP family protein